SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000002006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000002006
Domain Number 1 Region: 688-796
Classification Level Classification E-value
Superfamily Bromodomain 1.28e-33
Family Bromodomain 0.00084
Further Details:      
 
Domain Number 2 Region: 1087-1187
Classification Level Classification E-value
Superfamily Bromodomain 5.89e-31
Family Bromodomain 0.00068
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000002006
Domain Number - Region: 57-113
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0209
Family Bacterial exopeptidase dimerisation domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000002006
Sequence length 1217
Comment (Macaca mulatta)
Sequence
HKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQ
YSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAE
LIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRLPTVMVRS
PIDSASPGGDYPLGDLTPTTMEEATSGVNESEMAVASGHLNSTGVLLEVGGVLPMIHGGE
IQQTPNTVAASPAASGAPTLSRLLEAGPTQFTTPLASFTTVASEPPVKLVPPPVESVSQA
TIVMMPALPAPSSAPAVSTTESVAPVSQPDNCVPMEAVGDPHTVTVSMDSSEISMIINSI
KEECFRSGVAEAPVGSKAPSIDGKEELDLAEKMDIAVSYTGEELDFETVGDIIAIIEDKV
DDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTVKQERLDF
EETENKGIHELVDIREPIAFLSSDMFDGPKPIGCVLYILIPVKVTIGVTLHEGLRISSMV
SLSLKNKVYLGCFFFSGFQASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTI
FGSQIKDAPGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATL
QSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTD
DIAPGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAV
EMQRDVLEQIQQFLATQLIMQTSESGISAKSLRGRDSTRKQDASEKDSVPMGSPAFLLSL
FMGHKWVWLDSEQDYPNDSELSNECRSLFSSWDSSLDLDVGSWRETEDPEAEELEESSPG
REPSELLVGDGGSEESQEAAKKVSHQNLLHFLSEVAYLMEPLCISSNESSEGCCPPSGTR
QEGREIKASEGERELCRETEELSAKGDPLVAEKPLGENGKPQVASAPSIICAVQGLLTES
EEGEAQQESKRENQGEVYVSETEDQPPSGECDDAFNIKETPLVDTLFNHATSTKLPDLSQ
DDPVQDHLLFKKTLLPVWKMIASHRFSSPFLKPVSERQAPGYNDVVKRPMDLTSLKRNLS
KGRIRTMAQFQRDLMLMFQNAVMYNDSDHHVYHMAVEMRQEVLEQIQVLNIWLDKRKGSS
SLEGEPANPVDDGKPVF
Download sequence
Identical sequences 9544.ENSMMUP00000002006 ENSMMUP00000002006 ENSMMUP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]