SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000002236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000002236
Domain Number 1 Region: 54-299
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.2e-70
Family Crotonase-like 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000002236
Sequence length 303
Comment (Macaca mulatta)
Sequence
MAAVAVLRAFGARGPMCLSRGPWAQLSARFCSRDPAGAGRRESEPRPTSARQLDGIRNIV
LSNPKKRNALSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY
HAEVFQTCSKVMMLIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNIG
LFCSTPGVALARAVPRKVALEMLFTGEPISAQQALLHGLLSKVVPEAELQEETMRIARKI
ASLSRPVVSLGKATFYRQLPQDLGTAYYLTSRAMVDNLALRDGQEGITAFLQKRKPIWSH
EPA
Download sequence
Identical sequences ENSMMUP00000002236 XP_001082412.1.72884 9544.ENSMMUP00000002236 ENSMMUP00000002236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]