SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000002459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000002459
Domain Number 1 Region: 153-297
Classification Level Classification E-value
Superfamily EF-hand 5.64e-52
Family Osteonectin 0.000000108
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000002459
Sequence length 299
Comment (Macaca mulatta)
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGPE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQSECLS
Download sequence
Identical sequences ENSMMUP00000002459 9544.ENSMMUP00000002459 ENSMMUP00000002459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]