SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000003400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000003400
Domain Number 1 Region: 445-574
Classification Level Classification E-value
Superfamily eIF1-like 2.62e-20
Family eIF1-like 0.0068
Further Details:      
 
Domain Number 2 Region: 375-475
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.23e-17
Family SWIB/MDM2 domain 0.01
Further Details:      
 
Domain Number 3 Region: 94-181
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000286
Family PUA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000003400
Sequence length 584
Comment (Macaca mulatta)
Sequence
MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAYKGDA
VTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMP
PAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSG
NKSSPPSIAPLALDSADLSEEKGSVQVDSTLQGDMRHMILEGEEENGEAHQACEEKSLSE
APEDTSTGGLNQDSTDSKTLQEQMDELLQQCFLHALKCRVKKADLPLLTSTFLGSHMFSC
CPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHPRITSFVIPEP
SPTSQTIQEGSREQPYHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIIINYAK
KNDLVDADNKNLVKLDPILCDCILEKNEQHTVMKLPWDSLLTRCLEKLQPAYQVTFPGQE
PIVKKGKICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVTSAPGA
KDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKAPKPGKKK
Download sequence
Identical sequences F7GX43 G7NVB3
ENSMMUP00000003400 ENSMMUP00000003400 9544.ENSMMUP00000003400 NP_001253699.1.72884 XP_005540697.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]