SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000003410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000003410
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-38
Family SCAN domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 402-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 487-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 216-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000017
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000003410
Sequence length 545
Comment (Macaca mulatta)
Sequence
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVSASCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEPAPQVPVGDQGQEMLCCKMALLTQTQGSQSNQCQPVKALFKHE
SLGSQPLQDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLSPGWTQLDSS
QVNIYRDEKQENHSSLVSLGGEKQTESRDLPPVKKLSKKEHGKICHLREDIAQNPTCAEA
GEQEGRLQRKQKNAVGSKRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGS
SALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL
EHHKIHTGEKPYQCNMCGKTFRRNSHLLRHQRIHGDKNVQNPEHGESWERQGRTESQWEN
IEAPMSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGK
KIISQ
Download sequence
Identical sequences A0A2K5UP85 F7GX29
XP_005553829.1.63531 XP_014991281.1.72884 ENSMMUP00000003410 ENSMMUP00000003410 9544.ENSMMUP00000003410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]