SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000003737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000003737
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-31
Family C-type lectin domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000000000464
Family Triple coiled coil domain of C-type lectins 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000003737
Sequence length 375
Comment (Macaca mulatta)
Sequence
MLLFLLSALVLLTQSLGYLEADMKTYSQRTAPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGKAGMPGEAGPVGPKGDNGSIGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGPAGPKGDRGVPGERGAPGNA
GAAGSAGVMGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQKQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAAL
QQLVIAQNEAAFLSMTDSKMEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
Download sequence
Identical sequences A0A2K6C6J1 G7N227 G7PEY0 Q1PBC5
ENSMMUP00000003737 NP_001035283.1.72884 XP_011712911.1.29376 XP_015002617.1.72884 9544.ENSMMUP00000003737 ENSMMUP00000003737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]