SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000004001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000004001
Domain Number - Region: 29-55
Classification Level Classification E-value
Superfamily WW domain 0.0697
Family WW domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000004001
Sequence length 84
Comment (Macaca mulatta)
Sequence
TESCFVTQAGVQWHNLGSLQPPPPGLKQFSCLSLPSSWDYRYTPPHPANFYIFSRDGVSP
CCPGCSWSRTPELRRSTHFGLPKC
Download sequence
Identical sequences ENSMMUP00000004001 9544.ENSMMUP00000004001 ENSMMUP00000004001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]