SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000004438 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000004438
Domain Number 1 Region: 60-180
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.75e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000004438
Sequence length 349
Comment (Macaca mulatta)
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGATTVPGYRAPPPPAHEAYEEYVTTKKYNGNNEIETFQTYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPPRSARGGYREHPYGRY
Download sequence
Identical sequences ENSMMUP00000004438 ENSMMUP00000004438 9544.ENSMMUP00000004438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]