SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000004450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000004450
Domain Number 1 Region: 496-864
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.83e-136
Family Hect, E3 ligase catalytic domain 0.00000000000447
Further Details:      
 
Domain Number 2 Region: 399-439
Classification Level Classification E-value
Superfamily WW domain 8.9e-16
Family WW domain 0.00051
Further Details:      
 
Domain Number 3 Region: 18-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000546
Family PLC-like (P variant) 0.0015
Further Details:      
 
Domain Number 4 Region: 296-331
Classification Level Classification E-value
Superfamily WW domain 0.00000000000529
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 331-364
Classification Level Classification E-value
Superfamily WW domain 0.00000000000548
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 441-476
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000004450
Sequence length 870
Comment (Macaca mulatta)
Sequence
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLASETKKTAKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENTQLT
LNLQTENKGSVVSGGELTIFLDGPTVDLGSVPNGSAVTDGSQPPSRDSSGTAVAPENRHQ
LPSTNCFGGRSRTHRHSGAAARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPT
TATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPD
ALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQP
PTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV
YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
SGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDL
RRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPD
HLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESVDPEFYNSIVWIKE
NNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQ
TKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFW
QVVKEMDNEKRIRLLQFVTGTCRLPIGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN
RLDLPPYKSYEQLREKLLYAIEETEGFGQE
Download sequence
Identical sequences F6RWN6
9544.ENSMMUP00000004450 ENSMMUP00000004450 ENSMMUP00000004450 NP_001254530.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]