SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000005460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000005460
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000005460
Sequence length 180
Comment (Macaca mulatta)
Sequence
GTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLI
VPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAI
VQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPA
Download sequence
Identical sequences 9544.ENSMMUP00000005460 ENSMMUP00000005460 ENSMMUP00000005460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]