SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000005845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000005845
Domain Number 1 Region: 3768-4139
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.97e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2778-3146
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.74e-100
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 3 Region: 242-598
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 4 Region: 4278-4551
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.06e-57
Family Hect, E3 ligase catalytic domain 0.00041
Further Details:      
 
Domain Number 5 Region: 2549-2731
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2374-2451
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.71e-29
Family CPH domain 0.00066
Further Details:      
 
Domain Number 7 Region: 1683-1749
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.48e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 8 Region: 1026-1110
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000772
Family Cytochrome b5 0.009
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000005845
Domain Number - Region: 2274-2326
Classification Level Classification E-value
Superfamily UBA-like 0.000432
Family UBA domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000005845
Sequence length 4564
Comment (Macaca mulatta)
Sequence
SSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASL
FDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQR
GTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICSKDTPHSEGDM
HLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKG
SLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSD
TLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKV
ISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGL
KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVV
KVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTH
CLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCS
EWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQL
HAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLSTVQSAAQSVLQSGWSVLLPT
AEERARALSALLPCAVSGNDVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIE
AKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIA
SQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSP
ELMGVGSLLKKYTALLCTHIGDILPVAASVASTSWRHFAEVACIVEGDFTGVLLPELVVS
IVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQN
CRNNEEVTLIRKADLENHNKDGGFWTVIEGKVYDIKDFQTQSLTGNSILAQFAGEDPVVA
LEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASYL
AMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSH
RRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRLL
LCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGR
SYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVP
KKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYK
WLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAS
KNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAV
QNIRNVLMDANAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGAN
NLDLLLNSGTLALTQTALRLIGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSG
PELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGK
EGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGV
HAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVCREQHRSWCTLGFVRSIALTPQVC
GALSSPQWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKL
FGFLGSLLTTCSSDVPLLRESTPRRRRARPQASLTATHSSTLAEEVVALLRTLHSLTQWN
GLINKYINSQLRCVTHSFAGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLG
GQVVHDEFGEGTVTRITPKGRITVQFSDMRTCRVCPLSQLKPLPAVAFNVNNLPFTEPML
SVWAQLVNLAGSKLEKHKIKKSTKQAFTGQVDLDLLRCQQLKLYILKAGRALLSHQDKLR
QILSQPAVQETGTVHADDGAVASPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDK
QELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALP
IVVQLMEMGFPRRNIEFALKSLTGASGNASGLPGVEALVGWLLDHSDVQVTELSDADTVS
DEYSDEEVVEDMDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCC
RAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIK
IGDKVRVKASVATPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVP
SIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFC
GRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWI
RLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLND
CTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNS
GSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGG
SKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHAT
ALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGEL
YTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDG
DFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHG
SDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKP
TLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADS
SAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQILYARDAVVGALMPA
AMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDMEDRLSPNPWQEKREIASSEDAVT
PSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGLEPQALDEFTSL
LIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVAT
DSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGTGPAPGRSCSVSTFRTADALVIMTQP
LGLISTRGRREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSD
RCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKL
LTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPVVRGGKQL
LHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEV
AKKIRELMADSENMDVLHESHDVFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNH
RGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGG
TESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDR
PRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQ
GHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVK
VECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHC
VCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKP
ASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPS
VGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTK
SVFGQMCAKMTSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLL
IVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQ
LAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTH
ITLDNRAEYVRLAINYRLVVICLSYSVIRVGVSWVVPSPVSCLPVGRSSATMVCGSPDIP
LHLLKSVATYKGIEPSTSLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDF
VIQV
Download sequence
Identical sequences ENSMMUP00000005845 9544.ENSMMUP00000005845 ENSMMUP00000005845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]