SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000005899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000005899
Domain Number 1 Region: 485-726
Classification Level Classification E-value
Superfamily vWA-like 3.11e-76
Family Trunk domain of Sec23/24 0.00000617
Further Details:      
 
Domain Number 2 Region: 258-403,727-819
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.45e-68
Family beta-sandwich domain of Sec23/24 0.00075
Further Details:      
 
Domain Number 3 Region: 928-1076
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.2e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.0009
Further Details:      
 
Domain Number 4 Region: 823-924
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.02e-25
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 404-484
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 3.01e-23
Family Zn-finger domain of Sec23/24 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000005899
Sequence length 1077
Comment (Macaca mulatta)
Sequence
PPGPERSRLGLGVSLHQRSCPKCIAVFTRVSEPRIQFPASRILLSSNTSKDFPVSGQSNY
GGSQGSRQTLNRPSVASNPVTPLLHSGPAPRMPLPTSQNSCTTPMPSSSFLPGANLPPPL
NWQYNYPSTATQTNHCPPASSQPTVSGNTSLTTNHQYVSSGYPSLQNSFVKSGSSVPPLV
NPPLPTTFQPGAPHGPPPAGGPPPIRALMPQTSSYRDVPQPSFNSAVNQEGITSTANNGS
MVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSLN
YPSGPQAFTQTPLGANHLTTSMSGLSLRPEGLRVVNLLQERNMLPSTPLKPPVPNLHEDI
QKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQLPVVTSSTIVRCRSCRT
YINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRRPEVQNATIEFMAPSEY
MLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRTKIGFITFDSTIHFY
SLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLKTLPQMFTKTLETQSAL
GPALLAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSSAKDIHLTPSTDFYKKL
ALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQHNPVQVQKLQKELQ
RYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGYAVQMSVEESLT
DTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADVQAISGLLANMAVDRSM
TASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLVVPFSLRLFPLFVLALLKQKSFQTGT
NARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNISDRTIPQPPILQLSVE
KLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQPMTDLPELDTPESARII
AFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSYYEFLLHIQQQVNK
Download sequence
Identical sequences ENSMMUP00000005899 ENSMMUP00000034119 9544.ENSMMUP00000005899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]