SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000006177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000006177
Domain Number 1 Region: 40-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-62
Family FAD-linked reductases, N-terminal domain 0.00000000000294
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.28e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000095
Further Details:      
 
Domain Number 3 Region: 516-614
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.94e-24
Family ETF-QO domain-like 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000006177
Sequence length 616
Comment (Macaca mulatta)
Sequence
MLVPLTKLSCPAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAAAHEKDIRVCLVEKAAQIGAHTLSGACLD
PAAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHVV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVKRNLSIYDGPEQRFCPAVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNI
NWVVPEGGGGPAYNGM
Download sequence
Identical sequences ENSMMUP00000006177 9544.ENSMMUP00000006177 ENSMMUP00000006176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]