SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000006547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000006547
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000113
Family Glutathione peroxidase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000006547
Sequence length 212
Comment (Macaca mulatta)
Sequence
MASLFSGRILICNNNDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVR
LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDELRRDLGRQFSVERL
PAVVVLKPDGDVLTRDGADEIQRLGTSCFANWQEAAEVLDRNFQLPEDLEDQEPRSLTEC
LRRRKYRVEKAARGGRDPGGGGGEEGGAGGLF
Download sequence
Identical sequences ENSMMUP00000006547 9544.ENSMMUP00000006547 XP_001113624.1.72884 ENSMMUP00000006547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]