SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000006696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000006696
Domain Number 1 Region: 24-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000218
Family EGF-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000006696
Domain Number - Region: 64-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000336
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 8-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000006696
Sequence length 95
Comment (Macaca mulatta)
Sequence
MQIFFHFFSLRCLPGFSGQFCEININECSSSPCLHGANCEDHINGYVCKCQPGWSGHHCE
KELECVPNSCVHQLCMENEPGSTCLCTPGFMVKII
Download sequence
Identical sequences ENSMMUP00000006696 ENSMMUP00000006696 9544.ENSMMUP00000006696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]