SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000006765 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000006765
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 6.18e-19
Family mono-SIS domain 0.0066
Further Details:      
 
Domain Number 2 Region: 29-279
Classification Level Classification E-value
Superfamily SIS domain 0.0000000054
Family mono-SIS domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000006765
Sequence length 625
Comment (Macaca mulatta)
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAEEIVRLLGQCDAEI
FQEEGQALPTYQRLYSESILTTMAQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKSLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
TAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TIVEQVKEKTSHIQALAHSTVGQNLPIPLKKLFPSVISITWPLLFFEYEGNFVQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQAHLAATPSVCEA
VRSALAGPGQKRTADPLEILEPDGQ
Download sequence
Identical sequences F7BYJ8
9544.ENSMMUP00000006765 ENSMMUP00000006765 XP_001098190.1.72884 ENSMMUP00000006765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]