SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000007053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000007053
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-26
Family SCAN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 348-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000419
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000007053
Domain Number - Region: 395-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00491
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000007053
Sequence length 432
Comment (Macaca mulatta)
Sequence
MALDLRTIFQHEPSENNLGSENSEFRRSQGPAVQTEEGISEFSRMMLNSFQDSNNSYARQ
ELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKATVKEKWKSSGKNLERFME
DLTDDIINPPALVHVHMQGQEALFSDNMPLKDVIVHLTKQVSAKTPREANMGTPFQTSQD
TSSETGQGREDEQDGCNSSLKTTQVNESNTNQDNPIVSLIIQEENGPRPKEGGVSSDNPY
NSRRTELDTARSQEGSTNGIIFQGVPMEMGAGFISQPEQSSPESAPTHQSNKGNSTCEVH
QKGSHGVRKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPKCQKGFFQISDLRVHQII
HTGEKPFTCSMCEKSFSHKTNLRSHERIHTGEKPYTCPYCKRSYRQSSTYHRHMRTHKKI
TLPTVPSTPEAS
Download sequence
Identical sequences F7GH55
XP_001099779.2.72884 ENSMMUP00000007053 ENSMMUP00000007053 9544.ENSMMUP00000007053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]