SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000007303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000007303
Domain Number 1 Region: 1-260
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.37e-66
Family Glycogenin 0.00000000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000007303
Sequence length 350
Comment (Macaca mulatta)
Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIM
VDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREEL
SAAPDPGWPDCFNSGVFVYQPSVETYNQLLRLASEQGSFDGGDQGILNTFFSSWATRDIR
KHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM
THPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAI
SHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Download sequence
Identical sequences A0A2K5NLR0 A0A2K5WZ67 A0A2K6BCY1 F7GFE5
ENSMMUP00000007306 ENSMMUP00000007303 XP_005546111.1.63531 XP_011720056.1.29376 XP_011919252.1.92194 XP_014987256.1.72884 9544.ENSMMUP00000007303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]