SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000008686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000008686
Domain Number 1 Region: 30-194
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.56e-48
Family MHC antigen-recognition domain 0.000000174
Further Details:      
 
Domain Number 2 Region: 207-289
Classification Level Classification E-value
Superfamily Immunoglobulin 1.62e-19
Family C1 set domains (antibody constant domain-like) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000008686
Sequence length 386
Comment (Macaca mulatta)
Sequence
MGLGRVLLFLGRVLLFLASIFSFTRPGAAAELHSLRYNVTVLSRDGSVQSEFLAEGHLDG
QLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIK
ICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMNFWKEDTMKTNTHY
RAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWR
QDGVSLSHDAQQWGDVLPDWNGTYQTWVATRIRQGEEQRFACYMEHSRNHSTHPVPSGKP
PVLQSERLNLLYVPVAVAVAVVTAFIIICVHRCKKKKTSAAEGPELVSLRTLDQHPVGTG
DHRDATQLGFQPLMSAPGSTGSTEGA
Download sequence
Identical sequences F7HME9
ENSMMUP00000008686 ENSMMUP00000008686 9544.ENSMMUP00000008686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]