SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000008795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000008795
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-42
Family Pentraxin (pentaxin) 0.00000000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000008795
Sequence length 223
Comment (Macaca mulatta)
Sequence
MNKLLLWVCVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITQLEKPLQNFTLCFRAYT
DLSRPYSLFSYNTQGKDNELVVYKERVGDYSLYIGRQKVTFKVIEKLPAPVHICVSWESS
SGIAECWINGTPLVKKGLRQGYSVEAHPKIVLGQEQDSYGGKFDKSQSFVGEIGDLYMWN
SVLPPEEILSAYQGTPVPANILDWRALNYEIKGYVIIKPLVWV
Download sequence
Identical sequences F7H1V9
9544.ENSMMUP00000008795 ENSMMUP00000008795 XP_001117234.1.72884 ENSMMUP00000008795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]