SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009108
Domain Number 1 Region: 384-497
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-24
Family PDI-like 0.001
Further Details:      
 
Domain Number 2 Region: 253-385
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.34e-20
Family ERP29 N domain-like 0.054
Further Details:      
 
Domain Number 3 Region: 43-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.51e-17
Family PDI-like 0.0069
Further Details:      
 
Domain Number 4 Region: 164-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000411
Family PDI-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009108
Sequence length 583
Comment (Macaca mulatta)
Sequence
MDLLWMPLLLVAARISAVHSSPEVNAGVSSIHITKPVHILEERNLLVLTPAGLTQMLNQT
RFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITVEKELQQEFGITKAPQ
LKLFFEGNRSEPISCKGVVESTALVVWLRRQISQKAFLFNSSLQVAEFVTSRPLVIVGFF
QDLEEEVAELFYDVIKDFPELTFGVITIGNAIGRFHVTLDSILVFKKGKIVNRQELINDS
TNKQELNRVIKQHLTDFVIEYNAENKDLIYELYIMSHMLLFVSKSSESFGIIIQHYKLAS
KEFQNKILFILVNADEPRNRRVIEYFRVTEVDIPSVQILNLSSDARYKMPSDDITYENLK
KFGRSFLSKNAKKHQSSEEIPKHWDQGLVKQLVGKNFNIVVFDKEKDVFVMFYAPWSKKC
KMLFPLLEELGRKYQNHSTIIIAKIDITANDIQLVYLDRYPFFRLFPTDSQQAVLYKGEH
TLKGFSDFLESYIKTSIEDEDELLSVEQNEVIEEEVRAKEKEVPMMKKELPEQQSPELEN
VTKHVSKLEESAGKKKTSEEVVVVAKPKGPPTQKKKPKVKEEL
Download sequence
Identical sequences F7E1Q7 Q95LM0
XP_001087695.1.72884 ENSMMUP00000009108 ENSMMUP00000009108 9544.ENSMMUP00000009108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]