SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009296
Domain Number 1 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 98-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009296
Sequence length 333
Comment (Macaca mulatta)
Sequence
SPTESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCG
PTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFIC
DGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLAL
VLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASE
VGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSANSASSQAASSLL
SVEDTGHSPGQPGPQEGTAEPRDSEPSQGTEEV
Download sequence
Identical sequences G7NDK6
ENSMMUP00000009296 ENSMMUP00000009296 9544.ENSMMUP00000009296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]