SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009467
Domain Number 1 Region: 948-1009
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000199
Family PHD domain 0.0035
Further Details:      
 
Domain Number 2 Region: 335-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000432
Family PHD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 898-956
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000731
Family PHD domain 0.019
Further Details:      
 
Domain Number 4 Region: 1022-1089
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000509
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 285-342
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000082
Family PHD domain 0.0095
Further Details:      
 
Domain Number 6 Region: 405-468
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000432
Family PHD domain 0.015
Further Details:      
 
Domain Number 7 Region: 1601-1648
Classification Level Classification E-value
Superfamily HMG-box 0.00000982
Family HMG-box 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009467
Sequence length 3533
Comment (Macaca mulatta)
Sequence
RPRSRGKTAVEDEDSMDGLETTETETIVETGIKTQDTVVRSRLTATSTHRVQAVLPASAS
QAGSYSLTQAGVQWRLSEQLCAFCYCGEKSSLGQGDLKQFRVTPGFILPWRNQPSNKKDI
DDNSNGTYEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGL
PDAIDVQALFDSTGTCWAHHRCVEWSLGVCQMEEPLSVNVDKAVVSGSTEKFCSFCFHLG
ATIKCCEEKCTQMYHYPCAAGAGTFHDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGD
LLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKG
YHTFCLQPVMKSVPTNGWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGK
CYHPELQKDMLHCNMCKRWVHLECDKPTDHELDPQLKEEYICMYCKHLGAEMDPLQPGEE
VEIAELTTDYNNEMEVEGPEDQMVFPEHAVSKDVNDQESTPGIVPDAVQVHTEEQQKSHP
SESLDTDSLLIAVSSQHKMNTELEKQISNEVDSEEMKTSSEVKHICGEDQMEDKMEVTEN
IEVVTHQIIVQQEELQLLEEPKTVVSKEESGPPKLVIESVTLPLETLVSPHEGSISLCPE
EQLVIERLQGEKEQKENSELSTGLMDSEMTPTIESCVKDVSYQGDKSIKLSSETESSFSS
SADISKADVSSSPTPSSDLPLHDMLHNYPSALSSSAGNIMPTTYISVTPKIGMGKPAITK
RKFSPGRPRSKQGAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPG
KRRPRGAGLSGRGGRGRSKLKSGIGAVVLPGVSAADISSNKDDEENSMHNTVVLFSSSDK
FTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEA
CGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQ
NNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFD
CSMCRPYMPASNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTV
TVPRRKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSP
EREAVDDETKGVEGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSIS
EQLPCRDDGWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDL
LDTSRQSKISLDNLSEDAAQLSYKTNMNAGFLDPSLDPLSSSSAPAKSGTHGPADDPLAD
ISEVLNTDDDILGIISDDLAKSVDHSDIGPVPDDPSLPQPSVNQSSRPLSEEQLDGILSP
ELDKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPIHNQD
VFSRMPLMNGLIGPSPHLPHNSLPPGSGLGTFSAIAQSPYPDARDKNSAFNPMASDPNNS
WTSSAPTVEGENDTLSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTR
VKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSE
LFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQFGSQHLL
VQSGSDTPSSGIQSPLTPQPGNGNMSPAQSFHKELFTKQPPSTPTSTSDDVFVKPQAPPP
PPAPSRIPIQEGLSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRPPPVGHSFS
RRNSAAPVENCTPLSSVSRPLQMNETTANRPSPVRDLYVFQRQRIPDPYARPLLTPAPLD
SGPGPFKTPMQPPPSSQDPYGSVSQASRRLSIDPYERPALTPRPIDNFSHSQSNDPYSQP
PLTPHPTMNESFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQSSGTARSNTD
PYSQPPGTPRPATVDPYSQQPPTPRPSTQTDLFVTSVTNQRHSDPYAHPPGTPRPGISVP
YSQPPATPRPRISEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALPGPLVRPPDTCSQTPR
PPGPGLSDTFSRVSPSAARDPYDQPPVTPRSQSDSFGTSQAAHDVADQPRPGSEGSFCAS
SNSPMHSQGQQFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKLREIILQQQQQ
KKIAGRQEKGSQDSPAVPHPGPLQHWQPENINQAFARPPPPYPGNIRSPVAPPLGPRYAV
FPKDQRGPYPPDVASMGMRPHGFRFGFPGGSHGTMLSQERFLVPPQQIQGSGVSPQLRRS
ISVDMPRPLNNSQMNNPVGLPQHFSPQSLPVQQHNILGQAYIELRHRAPDGRQRLPFSAP
PGGAVEASSNLRHGNFIPRPDFPGPRHTEPMRRPPHGLPNQLPVHPDLEQVPPSQQEQGH
SVHSSSVVMRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEEKLDSDDPSVK
ELDVKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDDLLRSGEFDII
AYTDPELDLGDKKSMFNEELDLPIDDKLDNQCASVEPKKKEQEDKTLVLSDKHSPQKKST
VTNEVKMEVLSPNSKVESKCETEKSDENKDNVDPTCSQASAHSDLNDGEKTSLHPCDPDL
FEKRTNRETADSSANVIQGSTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPLGS
PPPTLPASPSNHVSSLPPLIAPPGHVLDNTVNSNVTVVSRVNHVFSQGVQVNPGFIPGQS
TVNHNLGTGKPTTQTGSLTSQSGTSSVSGPQQLMIPQTLAQQNRERPLLLEEQPLLLQDL
LDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNLGM
PPMVMSRFPFMGQAVTGTQNSEGQNLGPQAISQDGSITHQISRPNPPNFGPGFVNDSQRK
QYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVT
EQQSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQQQQCAMAPPTMMPSVQPQPPLIPGAT
PPTMSQPSFPMVPQQLQHQHQQHTTVISGHTSPVRMPNLPGWQPNSAPAHLPLNPPRIQP
PVAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRI
QLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPPRPLQQSP
QHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVK
QGHGSLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPASTQSLIQLY
SDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPSISETTSTPAV
Download sequence
Identical sequences ENSMMUP00000009467 9544.ENSMMUP00000009467 ENSMMUP00000009471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]