SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009484
Domain Number 1 Region: 472-584
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-47
Family Noncollagenous (NC1) domain of collagen IV 0.0000016
Further Details:      
 
Domain Number 2 Region: 359-469
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-42
Family Noncollagenous (NC1) domain of collagen IV 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009484
Sequence length 585
Comment (Macaca mulatta)
Sequence
LGTPGPPGPKGISGPPGNPGLPGETGPVGKHEKIKKGAYGNKSGGGRPGQPGPPGEKGKP
GQDGIPGPAGQKGEPGQPGFGNPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFHG
FPGVQGPPGPPGSPGPALEGPKGNPGPQGPPGRPGPTGFQGLPGPEGPPGLPGNGGIKGE
KGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPGFPGMKGPSGIPGS
AGPEGEPGLTGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPGPTG
PPGDPGRNGLPGFDGAGGRKGDPGLPGQPEIGTRGLDGPPGPDGLQGPPGPPGTSSIAHG
FLITRHSQTTDAPQCPQGTLQIYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFC
NINNVCNFASRNDYSYWLSTPEPMPVSMQPLKGQSIQPFISRRCAVCEAPAVVIAVHSQT
IQIPRCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY
YANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQVCMKRT
Download sequence
Identical sequences ENSMMUP00000009484 9544.ENSMMUP00000009484 ENSMMUP00000009484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]