SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000009487 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000009487
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.52e-38
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 394-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 480-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 210-254
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000994
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000009487
Sequence length 538
Comment (Macaca mulatta)
Sequence
MARELSESTALDAQPTEDKMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGP
REALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGKLQSWVREQHPESGEEVVVL
LEYLERQLDEPAPQVSGVDQGQELLCCKMALLTPAPESQSSQFQLMKALLKHESLGCQPL
QDRVLQVPVLAHGGCCREDTVVASRLTPESQGLLKVEDVALTVTPEWTQQDSSQGNLCRD
EKQENHGSLVSLGGEKQTKGRDLPPAEKLQEKEHGKILCHLREDIVQIPTCAEAGEQEGR
LQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIH
QRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRTESQLENVETPMSY
KCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKAFTRVSYLVQHQRSHVGRNILSQ
Download sequence
Identical sequences A0A2K5VV45 F7EGB2
ENSMMUP00000023729 9544.ENSMMUP00000009487 XP_001100960.1.72884 XP_005553774.1.63531 XP_014991286.1.72884 XP_015305193.1.63531 ENSMMUP00000009487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]