SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010118
Domain Number 1 Region: 268-382
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.12e-33
Family PDI-like 0.0059
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-30
Family PDI-like 0.0041
Further Details:      
 
Domain Number 3 Region: 115-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-26
Family PDI-like 0.0096
Further Details:      
 
Domain Number 4 Region: 35-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000824
Family ERP29 N domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010118
Sequence length 519
Comment (Macaca mulatta)
Sequence
MARAGPAWLLLAIWVVLPLWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSIVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDILEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTAAADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFTEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
Download sequence
Identical sequences F7CEQ3
ENSMMUP00000010118 ENSMMUP00000010118 XP_001112864.1.72884 9544.ENSMMUP00000010118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]