SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010192
Domain Number 1 Region: 404-547
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 300-405
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-34
Family Second domain of FERM 0.00000447
Further Details:      
 
Domain Number 3 Region: 220-299
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.36e-26
Family First domain of FERM 0.0000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010192
Sequence length 1006
Comment (Macaca mulatta)
Sequence
MTTEVGSASEVKKDSGQLGTDATKEKPKEVAENQQNQSSDLEEEKGSQPAPAAESQSSLR
RQKREKETSESRGISRFLPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPE
EQRQDKGDAEEMAQKKLQEIKVEVKEEKPSVSKDEGKYTFYWNFQPTELVSKEREEKVKE
TQEDKFEGEAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKRAK
GQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPP
DPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLS
EFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDI
KLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHR
AAKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHF
ERTSSKRVSRSLDGAPIGVVDQSLMKDFPDAAGEISAYGPGVVSIAVIQDGDGRREVRSP
AKAPHLQLIEGKKNSLRVEGDNIYVRHSNLMLEELDKAQEDILKHQASISELKRNFMEST
PEPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSG
PGEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEE
EPRPAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMG
EEAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQT
ETKTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIV
ITGDADIDHDQALAQAIREAREQHPDMSVTRVVVHKETELAEEGED
Download sequence
Identical sequences 9544.ENSMMUP00000010192 ENSMMUP00000010192 ENSMMUP00000010192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]