SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010434
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0035
Further Details:      
 
Domain Number 2 Region: 326-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000181
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010434
Sequence length 533
Comment (Macaca mulatta)
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFT
NSSKEMMCFPDFPYPDDFPNFMHNSKIQEYLTAFAKEKSLLKYIQFKTFVSSVNKRPDFA
TTGQWDVTTERDGKRESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFKGKRVLVVGLGNSGCDIATELSHTAEQVVISSRSGSWVMSRVWDNGYPWDMVLITRFG
TFLKNNLPTAISDWLYMKQMNARFKHENYGLMPLNGIILRKEPVFNDELPACILCGIVSV
KPNVKKFTETSAIFEDGTTFEGIVCVLYATGYSYAYTFLDESIIKNRNNEIILFKGVFPP
LLEKSTIAVIGFVQSLGAAIPTVDLQSRWAARVIKGTCTLPSMEDMMNDINEKMERKHKW
YGKSETLQTDYIVYMDELSSFIGVKPNIPWLFLTDPKLAMEVYFGPCSSYQFRLVGPGKW
PGARNAILTQWDRSLKPLQTRVVGTLQKPRFFFHWLKLFAIPILLIAVFLVLT
Download sequence
Identical sequences 9544.ENSMMUP00000010434 ENSMMUP00000010432 ENSMMUP00000010434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]