SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010944
Domain Number 1 Region: 60-178,208-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-20
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010944
Sequence length 362
Comment (Macaca mulatta)
Sequence
MAFQKAVKATILVGRSALATLGLSQLAYHRRKQMSLVYVEAADCISEPVNREPPSRDAQL
LTLQKSEVDILVMEGEATGSGCVLDAITRGLKTLVERDDFSSGTSSRSTKLIHGGVRYVQ
KAMMKLDIEQYRMVTEALDERANLPEIAPLLSAPLSIMLPVYKWWQLPYYWVGIKLYDFV
AGSNCLKSYVLSKSRALEYCPMLQKDKLVGGIVCYMGDIMMHMNLAIELTADRYGGATVN
DREVVSLLKKTDTKTGKLHVSGAWCKDVLKGQECDMRAKCVINAMGHFTDTVCKMDDKDA
AAICQPSAGVHIVMPGYYSPESIGLLEHIFFLPWQKMMTAGTTDTPTGITHHPLPSEDIN
FI
Download sequence
Identical sequences ENSMMUP00000010944 ENSMMUP00000010944 9544.ENSMMUP00000010944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]