SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000011034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000011034
Domain Number 1 Region: 133-272
Classification Level Classification E-value
Superfamily ISP domain 2.62e-40
Family Rieske iron-sulfur protein (ISP) 0.000000764
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.22e-22
Family ISP transmembrane anchor 0.0000348
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 9.48e-16
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000011034
Sequence length 273
Comment (Macaca mulatta)
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPKPPVLLKRPFLSRESLSGQAVR
RPLVASVGLNVPASVCYSHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYMVTAVT
TVSVAYAAKNVVTQFISTMSASADVLAMAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQ
KEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGFYCPCHGS
HYDASGRIRLGPAPLNLEVPPYEFTSDDMVVVG
Download sequence
Identical sequences ENSMMUP00000011034 9544.ENSMMUP00000011034 ENSMMUP00000011034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]