SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000011197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000011197
Domain Number 1 Region: 17-274
Classification Level Classification E-value
Superfamily HemD-like 3.79e-69
Family HemD-like 0.000000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000011197
Sequence length 281
Comment (Macaca mulatta)
Sequence
MFPCSVTAPYKDCQAIMKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLP
SFSEKLSHPEDYGGLIFTSPRAVEAAQLCLEKNNKTEVWERSLKEKWNAKSVYVVGNATA
SLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMES
VTVYQTIPHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAI
GPTTARALAAQGLPVSCTAESPTPQALATGIRKALQPHGCC
Download sequence
Identical sequences A0A2K5VG84
ENSMMUP00000011198 ENSMMUP00000011197 9544.ENSMMUP00000011197 XP_005566768.1.63531 XP_011720658.1.29376 XP_015003915.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]