SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000011225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000011225
Domain Number 1 Region: 24-184
Classification Level Classification E-value
Superfamily Lipocalins 5.02e-20
Family Retinol binding protein-like 0.0065
Further Details:      
 
Domain Number 2 Region: 213-272
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00012
Further Details:      
 
Domain Number 3 Region: 275-327
Classification Level Classification E-value
Superfamily BPTI-like 3.26e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000011225
Sequence length 341
Comment (Macaca mulatta)
Sequence
MRSLGALLLLLSACLVVSAGPVPTPPDNIQVQENFNVSRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGTTEAEISMTSTRWRKGVCEEMSGAYEKTDTDGKFLYHKSSKWSGRHA
HSLLCLKYLDVLSSPCLCNRSSHLAEMETLLQDFRVVAQGVGIPEDSIFTMADRGECVPG
EQEPEPILIPRARRAVLPQEEEGSGGGRLVTDVTKKEDSCQLGHSAGPCMGMTSRYFYNG
TSMACETFQYGGCMGNGNNFMTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGK
CVLFTYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Download sequence
Identical sequences 9544.ENSMMUP00000011225 ENSMMUP00000011225 ENSMMUP00000011225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]