SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012005
Domain Number 1 Region: 100-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.42e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 281-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.9e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 223-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.04e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 187-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000387
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family LIM domain 0.00091
Further Details:      
 
Domain Number 6 Region: 158-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000101
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000012005
Domain Number - Region: 340-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0189
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012005
Sequence length 387
Comment (Macaca mulatta)
Sequence
MAFSGRARPCVIPENEEIPPAALNSVPEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKY
CEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLC
RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGE
LYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLA
YCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKP
VCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences F7HRP5 G7PMX1
9544.ENSMMUP00000012005 ENSMMUP00000012005 ENSMMUP00000036177 XP_001082828.2.72884 XP_005575273.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]