SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012039 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012039
Domain Number 1 Region: 195-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 157-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 116-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 4 Region: 74-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000012039
Domain Number - Region: 8-64
Classification Level Classification E-value
Superfamily YWTD domain 0.00085
Family YWTD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012039
Sequence length 435
Comment (Macaca mulatta)
Sequence
LAGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTG
IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGE
ADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDS
PAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAP
GGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNP
PPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKAS
KYYLDLNSDSDPYPP
Download sequence
Identical sequences 9544.ENSMMUP00000012039 ENSMMUP00000012039 ENSMMUP00000012039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]