SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012173
Domain Number 1 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.43e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 22-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 211-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000107
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012173
Sequence length 487
Comment (Macaca mulatta)
Sequence
MAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQEEWGLLDEAQRRLYLEVMLENF
ALVASLGCGHGTEDEETPSEQNVSVRVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPG
QKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKRCLFRMSLKPFLKWEVGKDLPAML
GLLRSLVFPGGKKPNTITECGEDVCSQKSHYKSRECGKASRHKHTPVHHPRVYTGKKLYE
CSKCGKAFRGKYSLVQHQRVHTGERPWECSECGKFFSQTSHLNDHRRIHTGERPYECSEC
GKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSF
SQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCSECGKSFSQSS
ILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECDKCGNSFSQCSSLIH
HQKCHNT
Download sequence
Identical sequences F7H3L6
ENSMMUP00000012173 XP_001094516.1.72884 ENSMMUP00000012173 9544.ENSMMUP00000012173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]