SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012289 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012289
Domain Number 1 Region: 571-711
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-46
Family Phosphotyrosine-binding domain (PTB) 0.0000167
Further Details:      
 
Domain Number 2 Region: 427-557
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-21
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012289
Sequence length 716
Comment (Macaca mulatta)
Sequence
MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCM
GPPDRLQQAPQAQAKATCFLPSPGEQALGTPEDLDSYIDFSLESLNQMILELDPTFQLLP
QGTGGPRAEPAQSTMSVRKKEEPEALDIKYIEVTSARSRCHDGPQRCSSPSVTPPFGSPR
SGGLLLSRDVPRETRSSSESLIFSGNQGRGHQRPLPPSEGLSPQPPNSPSISIPCMGSKA
LSPHGLGSPLVASPRLEKRLGGLAPQRASRISVLSASPASDVSYMFGSSQSLLHSSNSSH
QSSSRSLESPASSSSSLHSLGSVSLCTRPSDFQAPRNPTLTMGQPRAPHCPPLAKEHASS
CPPSITNSMVDIPIVLINGCPEPGSSPPQWSPGHQSSVRPGAASPSNQVCPGTRSHSQTL
SDAPFTTCPEGPTRDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSY
RGSFGLALKVKEVPPSAQNRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVC
QHSIMALALPCKLTIPQRELGGADGASDSTDSPASCQRKSAGCHTLYLSSVSVETLTGAL
AVQKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLTTLRFCGMDPEQR
KWQKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDTVQPASQVISLVTALLQDVERM
Download sequence
Identical sequences ENSMMUP00000012289 XP_014975077.1.72884 9544.ENSMMUP00000012289 ENSMMUP00000025485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]