SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9544.ENSMMUP00000012321
Domain Number - Region: 248-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00468
Family APC10-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012321
Sequence length 376
Comment (Macaca mulatta)
Sequence
MPRSSRSPGDPGAPLEDVAHNPRPRRIAQRGRNTSRMVEDTSSNMNDNFLLPVRINAQAL
GLTQCMLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI
HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNLLIAKLQEMEAMSDEQK
VAQKIMKMIHGDYIEKPDFALKSTGASIDFEHTSATYNHEKAHSYWNWIQLWNYAQPPDL
AEEPNVTPGNCWAFEGNRGQVTIQLAQKVYLSNLTLQHIPKTISPSGSLDTAPKDFVIYG
MEGSPKEEVFLGAFQFQPESIIQMFPLQNQPARAFGAVKVKISSNWGNPAFTCLYRVRVH
GSVAPPXEQASPEPLP
Download sequence
Identical sequences ENSMMUP00000012321 9544.ENSMMUP00000012321 ENSMMUP00000012320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]