SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012372
Domain Number 1 Region: 363-725
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.93e-128
Family Hect, E3 ligase catalytic domain 0.00000000346
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-21
Family PLC-like (P variant) 0.039
Further Details:      
 
Domain Number 3 Region: 275-315
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 137-176
Classification Level Classification E-value
Superfamily WW domain 0.0000000000142
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 229-270
Classification Level Classification E-value
Superfamily WW domain 0.00000000025
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012372
Sequence length 732
Comment (Macaca mulatta)
Sequence
TVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVT
ISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSL
QSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYS
SPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEG
YEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFV
DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTECLTVPRYKRDLVQKL
KILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGG
VAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFH
GHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAY
GEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKT
FDEKELELIICGLGKIDVSDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVT
GSSRVPLQGFKALQGAAGPRLFTIHQIDACTDNLPKAHTCFNRIDIPPYESYEKLYEKLL
TAIEETCGFAVE
Download sequence
Identical sequences ENSMMUP00000012372 ENSMMUP00000012372 9544.ENSMMUP00000012372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]