SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012671
Domain Number 1 Region: 248-482
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.9e-28
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000981
Family LIM domain 0.0031
Further Details:      
 
Domain Number 3 Region: 146-198
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000102
Family PDZ domain 0.035
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000012671
Domain Number - Region: 52-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0002
Family LIM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012671
Sequence length 512
Comment (Macaca mulatta)
Sequence
FRCSECQDSLTRWFYEKDGKLYCHRYWEMFGEFCHGCSLLMTGPIIVAGECFACMSYKVT
IEDGDAYALVLCVTLYCGKYHNEVVLAPIFERLSTESIQDQLPYSVMLMSMLATTEGRQS
FSVSVENACSNYITTMQVKEVKQMHISPNSHNAIHPRDHILEISGTPIHTLQVEELEDAI
NQMSQTLLLLIEHDPVSQCPAQLRLDAWLSPHMQNAGHPHALITLDTKDNPEGMLRRCSL
RLSNSISKSCDVSHWESLCCSSTYSKQIFRSCDLIHGEVLGKGFFGQSIKVTHKATGKVV
VMKELMRCDEENQKTFLTEVLDHPNVLKFIGVLEDIEGGTLKDFPQSVNPFPWQQEVSLA
KGIASRMATSKKCNLHKNNFKKCYTVVGNLYWVTPEMLNRKSYDEVDVFSFGVILCEAIE
QMYADPDFLPQTLDFGLSMMLFWEKFVPTDCPPTFFPLATTCCRLEPKSRLAVSKLEDSL
YLVELGIPLPVGLEELGHTKQNKRDEWMHHQE
Download sequence
Identical sequences ENSMMUP00000012671 9544.ENSMMUP00000012671 ENSMMUP00000012671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]