SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000014318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000014318
Domain Number 1 Region: 88-200
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-21
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000014318
Sequence length 399
Comment (Macaca mulatta)
Sequence
MEFPLAQICPQGSHKAPIPTFSTFQITDMTHRSCRNLGYTAASPQALEAASIPGNAERAE
EVPGEGSLSLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRRFRPPLSVTHREAERLLE
PKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLGDGRHVVLGEDSAHERLQDLLRHY
TAHPLSPYGETLTEPLARQTPEPAGLPLRTEESNSGSKSQDPNPEYSPIIKQGQATVPMR
KEAAREKEPSQPLRPKPPIPAKPQLPPEVYTSPVSRRLPAPPPKPSNPIYNEPDEPIAFY
AMGRGSPGEAPSNIYVEVEDEGPPATLGHPVLRKSRSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
Download sequence
Identical sequences A0A1D5QZZ0
ENSMMUP00000014318 9544.ENSMMUP00000014318 ENSMMUP00000014318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]