SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000014356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000014356
Domain Number 1 Region: 436-494
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-17
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000014356
Sequence length 593
Comment (Macaca mulatta)
Sequence
MALTDGGWCLPKRFGAAGADASDSGAFPARDPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDAEAAAGPPARSLLLSSYASHPFGVPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSAGLSRPESGSAEAILFTSSQTLLWVISNLTHTLNSCVWEPLGG
ENAIVKNTWKCLPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLA
MKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAG
APVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences 9544.ENSMMUP00000014356 ENSMMUP00000014356 ENSMMUP00000014356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]