SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000014406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000014406
Domain Number 1 Region: 585-864
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-69
Family Protein kinases, catalytic subunit 0.00000814
Further Details:      
 
Domain Number 2 Region: 279-558
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-42
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 144-247,284-308
Classification Level Classification E-value
Superfamily SH2 domain 2.57e-17
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 39-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000344
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000014406
Sequence length 897
Comment (Macaca mulatta)
Sequence
RHSLMAKYIMDLERLDPAGAAETFHVSLPGVPGGQDGLGLLRVAGDGGIAWTQGEQEVLQ
PFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDS
FLLTVCVQTPLGPDYKGCLIRRSPTGSFFLVGLSRSHSSLRELLAACWDGGLHVDGVTVT
LTSCCIPRPKEKSNLIVVQRGRSPPTSSLVQPQSQCQLSQMIFHKIPADSLEWHENLGHG
SFTKIYRGCRHEVVDGESRKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGV
CMAGDSTMVQEFVHLGAIDTYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSA
RKVLLAREGTDGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLRKAQTLSLEADKWG
FGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSF
RAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGK
GNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVS
YGPGEPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVH
RDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQ
SDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACP
AEVHELMKLCWAPSPQDRPSFSTLGPQLDMLWSGSRGCETHAFTAHPEGKPHSLSFL
Download sequence
Identical sequences ENSMMUP00000014406 ENSMMUP00000014406 9544.ENSMMUP00000014406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]