SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000015313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000015313
Domain Number 1 Region: 92-167
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000015313
Sequence length 242
Comment (Macaca mulatta)
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK
Download sequence
Identical sequences A0A096MUF4 A0A2K5HU88 A0A2K5L9Z1 A0A2K5YY03 A0A2K6AYJ7 A0A2K6L970 F7HGT9 G3QP01 G7PIK1 H2NI59 H2Q6J2 P23409
9544.ENSMMUP00000015313 9598.ENSPTRP00000008936 9600.ENSPPYP00000005473 9606.ENSP00000228641 ENSP00000228641 NP_002460.1.87134 NP_002460.1.92137 XP_001086944.1.72884 XP_001164135.1.37143 XP_002823591.1.23681 XP_003811709.1.60992 XP_004053670.1.27298 XP_005571690.1.63531 XP_008002313.1.81039 XP_011725338.1.29376 XP_011789504.1.43180 XP_011849773.1.47321 XP_011905234.1.92194 XP_017730103.1.44346 ENSPPYP00000005473 ENSP00000228641 gi|4505299|ref|NP_002460.1| ENSP00000228641 ENSMMUP00000015313 ENSGGOP00000004284 ENSMMUP00000015313 ENSPANP00000003455 ENSGGOP00000004284 ENSPPYP00000005473 GO.41779 HR4530 ENSPTRP00000008936 ENSPTRP00000008936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]