SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000015367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000015367
Domain Number 1 Region: 212-678
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-48
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 2 Region: 627-811
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.68e-16
Family WD40-repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000015367
Sequence length 812
Comment (Macaca mulatta)
Sequence
DDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPT
KARPLMQTLPLRTTVNNGTVLPKKSSGSLPSPSGARKETAVPTTKRLNRSVSLLNACKLN
RSTPSNIKRTSSSERVSPGGRRESNGDSKGNRNRTGSTSSSSSGKKNSESKPKEPVFSAE
EGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPT
GETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPP
HVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEK
LADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLC
VTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRK
LISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHT
DELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGT
LTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYT
RVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTC
TLGFHVFGVWPEGSDGTDINAVSRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGH
SSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences ENSMMUP00000015366 ENSMMUP00000015367 9544.ENSMMUP00000015367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]