SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000016129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000016129
Domain Number 1 Region: 76-184
Classification Level Classification E-value
Superfamily Cadherin-like 6e-26
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 185-300
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 296-419
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.0088
Further Details:      
 
Domain Number 4 Region: 405-510
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 3-83
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000003
Family Cadherin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000016129
Sequence length 711
Comment (Macaca mulatta)
Sequence
LHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDREEKAFYTLRAQAINRRTL
RPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVVQVTATDADDPSYGNSAR
VIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAKDMGGQMGGLSGTTTVNI
TLTDVNDNPPRFPQNTIHLRVLESSPVGTAIGSVKATDADTGKNAEVEYRIIDGDGTDMF
DIVTEKDTQEGIITVKQPLDYESRRLYTLKVEAENTHVDPRFYYLGPFKDTTIVKISIED
VDEPPIFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFSLDRHTDLDRIFNIHSG
NGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFV
CENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDNEDNTARILTRKNGFNRH
EISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSAEALLLPAGLSTGALIAI
LLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRN
PAAIEEKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKEHDLDPTAPPYDSLATYA
YEGNDSIAESLSSLESGTTEGDQNYDYLREWGPRFNKLAEMYGGGESDKDS
Download sequence
Identical sequences 9544.ENSMMUP00000016129 ENSMMUP00000016129 ENSMMUP00000016129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]