SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000016471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000016471
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-33
Family Calponin-homology domain, CH-domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 215-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000941
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000016471
Sequence length 907
Comment (Macaca mulatta)
Sequence
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYE
NNKLAFRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKR
ASEDSEEEPSEKKAPVQPATLPSPTPTRKPPLSPAQTNPVVQRRNGGAEGPPPKTDSVLA
RATRTGSPGLLCGAGVRTLRRGISELGLLCLSSPRCKQCSCTLHSGAYRATGEPGAFVCT
SHLPATTSASPKLPGLVPQRPGAMAVNSRTPCSPQKAQEANKPKARPSAWEPAAGNSPAR
ASVPTTPNPPATSAASVRVRSPARPSESCAAPTPLEGKVRPRVTNSSPMGWSSAAQRTAA
AASHPPVPPSAPDPRPATSQGGGAPRVAAPQTTVSSSSTSAATVDPPAWTPSASRTQQAR
NKFFQTSAVPPGTSPAGRGPASSLAPSRDSSKEQARNFLRQALSALEEAGAPTPGRPSPA
TAPVPSSQPKTETPQASPLAKPLQPTSPQAFGIPSRTDPPAPLSTSSTSQASVSPPAGRR
SLAKPSGVGRVGAGSRPKPEAPTAKGKSTTLTQDGSASPQEGQEDGPAGWRANLKPVDRR
SPAERTLKPKEPRALAELRAGETPGKVSGSFAGSVHITLTPVRPERTPRPASPGPSLPAR
SPSPPRRRRLAIPASLDVSDNWLRPEPPEQEARAQSWKEEEKKPHLQGKPGRPLSPANVP
APPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEGDDAEDGL
MVDWFWLIHEKQLLLRQESELMYKSKDQRLEEQQLDIEGELRRLMAKPEALKSPQERQQE
QELLERYVSTVNDRSDIVDSLDEDRLRRQGQDCMTSLSTCALGLQRKKSKFRLSKIWSPK
SKSKSST
Download sequence
Identical sequences 9544.ENSMMUP00000016471 ENSMMUP00000016471 ENSMMUP00000016471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]