SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000016786 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000016786
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000706
Family ATI-like 0.047
Further Details:      
 
Domain Number 2 Region: 660-723
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000602
Family ATI-like 0.089
Further Details:      
 
Domain Number 3 Region: 764-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000929
Family ATI-like 0.012
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000016786
Domain Number - Region: 819-868
Classification Level Classification E-value
Superfamily FnI-like domain 0.000146
Family Fibronectin type I module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000016786
Sequence length 1567
Comment (Macaca mulatta)
Sequence
MLRPWLLLSCCGALLSTGDSNGGSTKSAVSRLTTAISVAPDKGQCSTWGAGHFSTFDHHV
YDFSGTCNYIFAATCKDAFPTFSVQLRRGTDRNISRIIVELGASIVTVSEATISVKDIGV
ISLPYTSNGLQITPFGQSVRLVAKQLELELEAVWGPDSHLMVLVERKYMGQMCGLCGNFD
GKVTNEFVSEEGKFLELHKFAALQKLDDPGEICTSEDIPNTHVRQVQHAQICTQLLTLVA
PECSVSKEPFVLSCQADVAAATQPGPQNSSCATLSEYSRRCSMVGQPVRRWRGPGLCSVG
QCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSSNHTCVPVTQCPCL
LNGAMYAPGEVTIAPCQTCQCTQGRWACRERPCPGHCSLEGGSFVTTFDARPYRFHGACT
YILLQSPQLPEDGALMAVYDKSGFSQSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPVFQAYITVGPQFRGQTRGLCGNFNGDT
TDDFTTSVGIAEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLVRTGT
VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACASRGVLLWGWRSSVDNC
TVPCTGNTTFSYNSQACERTCLSLSDRAAECHASAVPVDGCNCPNGTYLNHKGECVRKAQ
CPCTLEGYKFILAEQSTIVNGVTCYCINGRLSCPQRPQMFLATCQAPKTFKSCSQSSENK
FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA
ELHTDCRTCTCSRGRWACQQGTHCPSTCTLYGEGHIVTFDGQRFVFDGNCEYILATDGCG
ANDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLSVRPG
TLSLVVDISVPGRYNLTLIWNRHMTILIRITRDSQDPLCGLCGNFNGNMKDDFETRSRYV
ASSELEFVNSWKESPLCGDVSFVADPCSLNAFRRSWAERKCSIINSQTFAACHSKVYHLP
YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPDFCPIYCGFYNTHTQD
SHGEYQYTQEANCTWHYQPCLCPGQPQSVPGSNIEGCYNCSQDEYFDHEEGVCVPCMPAT
TPQPSTTVPVPFPGSRPTQVWPTTGTSTTIGLLSSTGPSPSSKHTPASPTQTPLLPATLT
SSKPTASSGESPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTST
AQSTTRTTVTPPTPATPGTSPTLSKSTDQELPGTTATQTTGPRPTPASTTGPTTPQPGQP
TRPTATETTQTGMTTEYTTPQTPHITHSPPSSPVSSTGPMTATSFQTTTTYPTPSHPQTT
LPTHGPSFSTSLVTPTTHTVITPTHAQMSTSSSIHSVPIGTIPPPTTVKVTGSTHTAPPI
TANTSGTSQALSSFSTAKTSTPLHSHTSSTHHPEVTLTSTIIVPNPTSTGTGTPVVHTTL
ATSSRLP
Download sequence
Identical sequences 9544.ENSMMUP00000016786 ENSMMUP00000016786 ENSMMUP00000016786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]