SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000016926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000016926
Domain Number 1 Region: 106-614
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 7.65e-191
Family Myeloperoxidase-like 0.00000000000000561
Further Details:      
 
Domain Number 2 Region: 65-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000016926
Sequence length 632
Comment (Macaca mulatta)
Sequence
MSRECDPGALRGQEVSWPPGGALNARLSRSSLSSAGSLLLQFLLLLLLLPQLPVLLADPG
APTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSF
THFLLTHGRWFWEFVNATFIRELLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYY
TRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQ
FFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEVYPPSVEE
APVLMHYPRGTPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQL
FQTTRLILIGETIRIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWH
PLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNMDHHVLHVA
VDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLL
LEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNIVKTATLKKLV
CLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Download sequence
Identical sequences 9544.ENSMMUP00000016926 XP_001088157.1.72884 ENSMMUP00000016926 ENSMMUP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]