SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017121
Domain Number 1 Region: 485-611
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 233-355
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 123-246
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 603-710
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 400-489
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000471
Family Cadherin 0.0038
Further Details:      
 
Domain Number 6 Region: 29-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000214
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017121
Sequence length 1070
Comment (Macaca mulatta)
Sequence
MSLVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQSVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
PRTGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLA
APGAPAASPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTV
RPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAE
VGSAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVL
DQNDHAPVLVHPAPANGSLEVAVPGRTAKDTAVARVQARDADEGANGELAFELQQQEPRE
AFAIGRRTGEIVLTSNLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGLAA
PASAGSPERSRPPGSRLGASGSALQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKE
VRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP
PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYSASPGFGKEPAPPVAVWKGHS
FNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGH
SDRCWSPSCSGPNTHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEK
VLHRDYDTTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANENV
Download sequence
Identical sequences ENSMMUP00000017121 ENSMMUP00000017121 9544.ENSMMUP00000017121 XP_001085113.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]