SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000017336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000017336
Domain Number 1 Region: 207-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000614
Family I set domains 0.043
Further Details:      
 
Domain Number 2 Region: 302-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000443
Family V set domains (antibody variable domain-like) 0.027
Further Details:      
 
Domain Number 3 Region: 57-112,143-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000296
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000017336
Sequence length 533
Comment (Macaca mulatta)
Sequence
MDSPSTPKASLGREGTETQALPAPCFSLGKHPGSFSTPASRLTPPPLGLSFAHLVKPPQP
GAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAPAPGHPPAPGHR
PAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAG
EYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRS
RGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPA
TPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQ
AQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPL
NTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGETLLGAAVYFTELSSPGAQRSGRAPGAL
RAGHLPLFLILGVLFLLLLVTGAFGFHLWRRQVSQGRANPAPPTAPPLPSSEC
Download sequence
Identical sequences ENSMMUP00000017336 ENSMMUP00000017336 9544.ENSMMUP00000017336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]